PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.D01880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 292aa    MW: 31565.8 Da    PI: 8.1134
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.D01880.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.36.6e-2676124250
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 
                     rien   rqvtfskRr g++KKAeEL vLCda+va+i+fs tgkl  ++
  Pahal.D01880.1  76 RIENAAARQVTFSKRRRGLFKKAEELAVLCDADVALIVFSATGKLSQFA 124
                     8*********************************************997 PP

2K-box58.62.6e-201552371698
           K-box  16 slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                       q +++ L++++ +  r +R++ Ge+Le Ls++eL+qLe++Le +l ++ s+K++l+++qi+elq+k  +l++en  L+k++
  Pahal.D01880.1 155 VEQSKYSGLNEQLAEASRGLRQMRGEELEGLSVEELHQLERKLEAGLHRVLSTKDQLFMQQISELQQKGAQLEDENSLLKKQV 237
                     45778888999999999**************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.5E-3467126IPR002100Transcription factor, MADS-box
PROSITE profilePS5006627.62867127IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-2869141IPR002100Transcription factor, MADS-box
PROSITE patternPS00350069123IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-236989IPR002100Transcription factor, MADS-box
PfamPF003193.4E-2576123IPR002100Transcription factor, MADS-box
CDDcd002651.36E-3279141No hitNo description
PRINTSPR004044.0E-2389104IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-23104125IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.212153243IPR002487Transcription factor, K-box
PfamPF014861.6E-20157237IPR002487Transcription factor, K-box
Gene3DG3DSA:1.20.5.4907.7E-4214237No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MAGVLVLATR RVVGVHARLA FWGAPFFPPL RESRGFLLPF SLSLSPCGCR TRGAAGGGVG  60
GARGGEMARE RRAIRRIENA AARQVTFSKR RRGLFKKAEE LAVLCDADVA LIVFSATGKL  120
SQFANTSMND IIDKYSTHSK NLGKSHQQPS IDLNVEQSKY SGLNEQLAEA SRGLRQMRGE  180
ELEGLSVEEL HQLERKLEAG LHRVLSTKDQ LFMQQISELQ QKGAQLEDEN SLLKKQVPQV  240
ITAGAAVVAA DTENVLTEDG QSSESVMTAL HSGSSHDNDD GSDISLKLSL P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D4e-1768138171Myocyte-specific enhancer factor 2A
3mu6_C4e-1768138171Myocyte-specific enhancer factor 2A
3mu6_B4e-1768138171Myocyte-specific enhancer factor 2A
3mu6_A4e-1768138171Myocyte-specific enhancer factor 2A
1egw_D6e-1768140173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C6e-1768140173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B6e-1768140173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A6e-1768140173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4306350.0AJ430635.1 Zea mays partial mRNA for putative MADS-domain transcription factor (m21 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964865.11e-146PREDICTED: MADS-box transcription factor 55-like
SwissprotQ9XJ661e-114MAD22_ORYSJ; MADS-box transcription factor 22
TrEMBLC5Z6K51e-131C5Z6K5_SORBI; Putative uncharacterized protein Sb10g007380
STRINGSb10g007380.11e-131(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12213697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-51MIKC_MADS family protein